Biochemistry

Sequence

The ordered list of amino acids in a peptide, written by single-letter or three-letter codes.

Definition

The amino acid sequence defines the identity and function of a peptide. Sequences are written from N-terminus to C-terminus using either single-letter (HGEGTFTSDVSSYLEGQAAKEFIAWLVKGR) or three-letter abbreviations.

Related terms

Amino AcidThe building block of peptides and proteins — 20 standard amino acids occur in human biology.
PeptideA short chain of amino acids linked by peptide bonds — generally fewer than 50 amino acids.

Back to the full peptide glossary.